CDS

Accession Number TCMCG036C10883
gbkey CDS
Protein Id PTQ40008.1
Location join(633535..633606,633858..633926,634314..634407,634957..635033)
GeneID Phytozome:Mapoly0042s0050
Organism Marchantia polymorpha
locus_tag MARPO_0042s0050

Protein

Length 103aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA53523, BioSample:SAMN00769973
db_source KZ772714.1
Definition hypothetical protein MARPO_0042s0050 [Marchantia polymorpha]
Locus_tag MARPO_0042s0050

EGGNOG-MAPPER Annotation

COG_category J
Description Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding
KEGG_TC 3.A.5.9
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko02044        [VIEW IN KEGG]
KEGG_ko ko:K03109        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03060        [VIEW IN KEGG]
map03060        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0005047        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005785        [VIEW IN EMBL-EBI]
GO:0005786        [VIEW IN EMBL-EBI]
GO:0005789        [VIEW IN EMBL-EBI]
GO:0005791        [VIEW IN EMBL-EBI]
GO:0006605        [VIEW IN EMBL-EBI]
GO:0006612        [VIEW IN EMBL-EBI]
GO:0006613        [VIEW IN EMBL-EBI]
GO:0006614        [VIEW IN EMBL-EBI]
GO:0006616        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0006886        [VIEW IN EMBL-EBI]
GO:0008104        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0015031        [VIEW IN EMBL-EBI]
GO:0015833        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0030867        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0033036        [VIEW IN EMBL-EBI]
GO:0033365        [VIEW IN EMBL-EBI]
GO:0034613        [VIEW IN EMBL-EBI]
GO:0042175        [VIEW IN EMBL-EBI]
GO:0042886        [VIEW IN EMBL-EBI]
GO:0043021        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044432        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044877        [VIEW IN EMBL-EBI]
GO:0045047        [VIEW IN EMBL-EBI]
GO:0045184        [VIEW IN EMBL-EBI]
GO:0046907        [VIEW IN EMBL-EBI]
GO:0048500        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0051641        [VIEW IN EMBL-EBI]
GO:0051649        [VIEW IN EMBL-EBI]
GO:0055085        [VIEW IN EMBL-EBI]
GO:0065002        [VIEW IN EMBL-EBI]
GO:0070727        [VIEW IN EMBL-EBI]
GO:0070972        [VIEW IN EMBL-EBI]
GO:0071702        [VIEW IN EMBL-EBI]
GO:0071705        [VIEW IN EMBL-EBI]
GO:0071806        [VIEW IN EMBL-EBI]
GO:0072594        [VIEW IN EMBL-EBI]
GO:0072599        [VIEW IN EMBL-EBI]
GO:0072657        [VIEW IN EMBL-EBI]
GO:0090150        [VIEW IN EMBL-EBI]
GO:0098588        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]
GO:0098827        [VIEW IN EMBL-EBI]
GO:1990904        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGTTTACGTAGAGTCATGGGACGATTTTTTGGAGCGAGCCGTCGTCATGTTTCGTGCTGATCCCGTCGGCACTCGCTATGTCATGAAGTACAGGCACTGCGATGGGAAATTGGTACTTAAAGTGACCGACGATCGCGGGTGCTTGAAATTCAAGACAGATCAATTGCAGGATGCCAAGAAGATGGAAAAGATGAACAACATTTTTTTCACACTGATGGCTCGAGGTCCTGATGCCGAATTTGTTGAAGAAGTCTCGCAGCCACCGACCCCACAACAACCAGCTAGGAAGAGTCGAGGAAGGAGGCAATGA
Protein:  
MVYVESWDDFLERAVVMFRADPVGTRYVMKYRHCDGKLVLKVTDDRGCLKFKTDQLQDAKKMEKMNNIFFTLMARGPDAEFVEEVSQPPTPQQPARKSRGRRQ